ARF7 polyclonal antibody (A01)
  • ARF7 polyclonal antibody (A01)

ARF7 polyclonal antibody (A01)

Ref: AB-H00080117-A01
ARF7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ARF7.
Información adicional
Size 50 uL
Gene Name ARL14
Gene Alias ARF7|FLJ22595
Gene Description ADP-ribosylation factor-like 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARF7 (AAH34354, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 80117

Enviar uma mensagem


ARF7 polyclonal antibody (A01)

ARF7 polyclonal antibody (A01)