TRMT2B purified MaxPab mouse polyclonal antibody (B02P)
  • TRMT2B purified MaxPab mouse polyclonal antibody (B02P)

TRMT2B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00079979-B02P
TRMT2B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRMT2B protein.
Información adicional
Size 50 ug
Gene Name TRMT2B
Gene Alias CXorf34|FLJ12687|dJ341D10.3
Gene Description TRM2 tRNA methyltransferase 2 homolog B (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKLSQEEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRMT2B (NP_079193.2, 1 a.a. ~ 504 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79979

Enviar uma mensagem


TRMT2B purified MaxPab mouse polyclonal antibody (B02P)

TRMT2B purified MaxPab mouse polyclonal antibody (B02P)