C18orf22 purified MaxPab mouse polyclonal antibody (B01P)
  • C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079863-B01P
C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C18orf22 protein.
Información adicional
Size 50 ug
Gene Name C18orf22
Gene Alias FLJ21172|HsT169
Gene Description chromosome 18 open reading frame 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C18orf22 (AAH14195, 1 a.a. ~ 343 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79863

Enviar uma mensagem


C18orf22 purified MaxPab mouse polyclonal antibody (B01P)

C18orf22 purified MaxPab mouse polyclonal antibody (B01P)