C12orf49 purified MaxPab mouse polyclonal antibody (B01P)
  • C12orf49 purified MaxPab mouse polyclonal antibody (B01P)

C12orf49 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079794-B01P
C12orf49 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C12orf49 protein.
Información adicional
Size 50 ug
Gene Name C12orf49
Gene Alias FLJ21415
Gene Description chromosome 12 open reading frame 49
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C12orf49 (NP_079014.1, 1 a.a. ~ 205 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79794

Enviar uma mensagem


C12orf49 purified MaxPab mouse polyclonal antibody (B01P)

C12orf49 purified MaxPab mouse polyclonal antibody (B01P)