ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)

ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079698-D01P
ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZMAT4 protein.
Información adicional
Size 100 ug
Gene Name ZMAT4
Gene Alias FLJ13842
Gene Description zinc finger, matrin type 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZMAT4 (AAH19598.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79698

Enviar uma mensagem


ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)

ZMAT4 purified MaxPab rabbit polyclonal antibody (D01P)