HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)
  • HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)

HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079618-B01P
HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name HMBOX1
Gene Alias FLJ21616|HNF1LA|PBHNF
Gene Description homeobox containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HMBOX1 (NP_078843.2, 1 a.a. ~ 420 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79618

Enviar uma mensagem


HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)

HMBOX1 purified MaxPab mouse polyclonal antibody (B01P)