C13orf7 monoclonal antibody (M06), clone 1B1
  • C13orf7 monoclonal antibody (M06), clone 1B1

C13orf7 monoclonal antibody (M06), clone 1B1

Ref: AB-H00079596-M06
C13orf7 monoclonal antibody (M06), clone 1B1

Información del producto

C13orf7 monoclonal antibody (M06), clone 1B1
Información adicional
Size 100 ug
Gene Name RNF219
Gene Alias C13orf7|DKFZp686A01276|DKFZp686N15250|DKFZp686O03173|FLJ13449|FLJ25774
Gene Description ring finger protein 219
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C13orf7 (NP_078822, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79596
Clone Number 1B1
Iso type IgG2a Kappa

Enviar uma mensagem


C13orf7 monoclonal antibody (M06), clone 1B1

C13orf7 monoclonal antibody (M06), clone 1B1