C13orf7 polyclonal antibody (A01)
  • C13orf7 polyclonal antibody (A01)

C13orf7 polyclonal antibody (A01)

Ref: AB-H00079596-A01
C13orf7 polyclonal antibody (A01)

Información del producto

C13orf7 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name RNF219
Gene Alias C13orf7|DKFZp686A01276|DKFZp686N15250|DKFZp686O03173|FLJ13449|FLJ25774
Gene Description ring finger protein 219
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C13orf7 (NP_078822, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79596

Enviar uma mensagem


C13orf7 polyclonal antibody (A01)

C13orf7 polyclonal antibody (A01)