KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)
  • KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)

KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079412-B01P
KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name KREMEN2
Gene Alias KRM2|MGC10791|MGC16709
Gene Description kringle containing transmembrane protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KREMEN2 (NP_078783.1, 1 a.a. ~ 420 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79412

Enviar uma mensagem


KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)

KREMEN2 purified MaxPab mouse polyclonal antibody (B01P)