BCL2L14 monoclonal antibody (M02), clone 1D11
  • BCL2L14 monoclonal antibody (M02), clone 1D11

BCL2L14 monoclonal antibody (M02), clone 1D11

Ref: AB-H00079370-M02
BCL2L14 monoclonal antibody (M02), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant BCL2L14.
Información adicional
Size 100 ug
Gene Name BCL2L14
Gene Alias BCLG
Gene Description BCL2-like 14 (apoptosis facilitator)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL2L14 (AAH25778.1, 1 a.a. ~ 327 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79370
Clone Number 1D11
Iso type IgG1 Kappa

Enviar uma mensagem


BCL2L14 monoclonal antibody (M02), clone 1D11

BCL2L14 monoclonal antibody (M02), clone 1D11