IRX1 monoclonal antibody (M04), clone 1A11
  • IRX1 monoclonal antibody (M04), clone 1A11

IRX1 monoclonal antibody (M04), clone 1A11

Ref: AB-H00079192-M04
IRX1 monoclonal antibody (M04), clone 1A11

Información del producto

IRX1 monoclonal antibody (M04), clone 1A11
Información adicional
Size 100 ug
Gene Name IRX1
Gene Alias IRX-5|IRXA1
Gene Description iroquois homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRX1 (NP_077313, 424 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79192
Clone Number 1A11
Iso type IgG2a Kappa

Enviar uma mensagem


IRX1 monoclonal antibody (M04), clone 1A11

IRX1 monoclonal antibody (M04), clone 1A11