IRX6 purified MaxPab rabbit polyclonal antibody (D01P)
  • IRX6 purified MaxPab rabbit polyclonal antibody (D01P)

IRX6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079190-D01P
IRX6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

IRX6 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name IRX6
Gene Alias IRX-3|IRX7|IRXB3
Gene Description iroquois homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAPYDSRLLGSARPELGAALGIYGAPYAAAAAAQSYPGYLPYSPEPPSLYGALNPQYEFKEAAGSFTSSLAQPGAYYPYERTLGQYQYERYGAVELSGAGRRKNATRETTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPKNKGGEERKAEGGEEDSLGCLTADTKEVTASQEARGLRLSD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRX6 (NP_077311.2, 1 a.a. ~ 446 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79190

Enviar uma mensagem


IRX6 purified MaxPab rabbit polyclonal antibody (D01P)

IRX6 purified MaxPab rabbit polyclonal antibody (D01P)