ZNF576 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF576 purified MaxPab mouse polyclonal antibody (B01P)

ZNF576 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079177-B01P
ZNF576 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF576 protein.
Información adicional
Size 50 ug
Gene Name ZNF576
Gene Alias FLJ22700|MGC2508
Gene Description zinc finger protein 576
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKTFGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF576 (NP_077303.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79177

Enviar uma mensagem


ZNF576 purified MaxPab mouse polyclonal antibody (B01P)

ZNF576 purified MaxPab mouse polyclonal antibody (B01P)