CRELD2 polyclonal antibody (A01)
  • CRELD2 polyclonal antibody (A01)

CRELD2 polyclonal antibody (A01)

Ref: AB-H00079174-A01
CRELD2 polyclonal antibody (A01)

Información del producto

CRELD2 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name CRELD2
Gene Alias DKFZp667O055|MGC11256
Gene Description cysteine-rich with EGF-like domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRELD2 (NP_077300, 162 a.a. ~ 258 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79174

Enviar uma mensagem


CRELD2 polyclonal antibody (A01)

CRELD2 polyclonal antibody (A01)