MMP28 monoclonal antibody (M01), clone 3C11
  • MMP28 monoclonal antibody (M01), clone 3C11

MMP28 monoclonal antibody (M01), clone 3C11

Ref: AB-H00079148-M01
MMP28 monoclonal antibody (M01), clone 3C11

Información del producto

MMP28 monoclonal antibody (M01), clone 3C11
Información adicional
Size 100 ug
Gene Name MMP28
Gene Alias EPILYSIN|MM28|MMP-28|MMP25
Gene Description matrix metallopeptidase 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSGRWATELPWMGCWHANSGSALF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP28 (NP_077278, 441 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79148
Clone Number 3C11
Iso type IgG2a Kappa

Enviar uma mensagem


MMP28 monoclonal antibody (M01), clone 3C11

MMP28 monoclonal antibody (M01), clone 3C11