MMP28 purified MaxPab rabbit polyclonal antibody (D01P)
  • MMP28 purified MaxPab rabbit polyclonal antibody (D01P)

MMP28 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00079148-D01P
MMP28 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

MMP28 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name MMP28
Gene Alias EPILYSIN|MM28|MMP-28|MMP25
Gene Description matrix metallopeptidase 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP28 (AAH02631, 1 a.a. ~ 393 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79148

Enviar uma mensagem


MMP28 purified MaxPab rabbit polyclonal antibody (D01P)

MMP28 purified MaxPab rabbit polyclonal antibody (D01P)