RNF26 monoclonal antibody (M01), clone 5B9
  • RNF26 monoclonal antibody (M01), clone 5B9

RNF26 monoclonal antibody (M01), clone 5B9

Ref: AB-H00079102-M01
RNF26 monoclonal antibody (M01), clone 5B9

Información del producto

RNF26 monoclonal antibody (M01), clone 5B9
Información adicional
Size 100 ug
Gene Name RNF26
Gene Alias MGC2642
Gene Description ring finger protein 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TIRVTPVRGRERLNEEEPPGGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNVYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF26 (NP_114404, 344 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79102
Clone Number 5B9
Iso type IgG3 Kappa

Enviar uma mensagem


RNF26 monoclonal antibody (M01), clone 5B9

RNF26 monoclonal antibody (M01), clone 5B9