TRIM48 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM48 purified MaxPab mouse polyclonal antibody (B01P)

TRIM48 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079097-B01P
TRIM48 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM48 protein.
Información adicional
Size 50 ug
Gene Name TRIM48
Gene Alias MGC4827|RNF101
Gene Description tripartite motif-containing 48
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNSGISQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECIKTIQQRNLKTNIRLKKMASLARKASLWLFLSSEEQMCGIHRETKKMFCEVDRSLLCLLCSSSQEHRYHRHCPAEWAAEEHWEKLLKKMQSLWEKACENQRNLNVETTRISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM48 (NP_077019.1, 1 a.a. ~ 208 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79097

Enviar uma mensagem


TRIM48 purified MaxPab mouse polyclonal antibody (B01P)

TRIM48 purified MaxPab mouse polyclonal antibody (B01P)