ZNF426 MaxPab mouse polyclonal antibody (B01P)
  • ZNF426 MaxPab mouse polyclonal antibody (B01P)

ZNF426 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00079088-B01P
ZNF426 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF426 protein.
Información adicional
Size 50 ug
Gene Name ZNF426
Gene Alias MGC2663
Gene Description zinc finger protein 426
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAADLSHGHYLSGDPVCLHEEKTPAGRIVADCLTDCYQDSVTFDDVAVDFTQEEWTLLDSTQRSLYSDVMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWSILQQDFLRGQTSIGIQLEGKHNGRELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF426 (NP_077011.1, 1 a.a. ~ 554 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79088

Enviar uma mensagem


ZNF426 MaxPab mouse polyclonal antibody (B01P)

ZNF426 MaxPab mouse polyclonal antibody (B01P)