SECISBP2 monoclonal antibody (M08), clone 3A7
  • SECISBP2 monoclonal antibody (M08), clone 3A7

SECISBP2 monoclonal antibody (M08), clone 3A7

Ref: AB-H00079048-M08
SECISBP2 monoclonal antibody (M08), clone 3A7

Información del producto

SECISBP2 monoclonal antibody (M08), clone 3A7
Información adicional
Size 100 ug
Gene Name SECISBP2
Gene Alias DKFZp686C09169|SBP2
Gene Description SECIS binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDEKKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SECISBP2 (NP_076982.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79048
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


SECISBP2 monoclonal antibody (M08), clone 3A7

SECISBP2 monoclonal antibody (M08), clone 3A7