TSEN34 polyclonal antibody (A01)
  • TSEN34 polyclonal antibody (A01)

TSEN34 polyclonal antibody (A01)

Ref: AB-H00079042-A01
TSEN34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSEN34.
Información adicional
Size 50 uL
Gene Name TSEN34
Gene Alias LENG5|PCH2C|SEN34|SEN34L
Gene Description tRNA splicing endonuclease 34 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSEN34 (NP_076980, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79042

Enviar uma mensagem


TSEN34 polyclonal antibody (A01)

TSEN34 polyclonal antibody (A01)