DDX54 monoclonal antibody (M01), clone 2H6
  • DDX54 monoclonal antibody (M01), clone 2H6

DDX54 monoclonal antibody (M01), clone 2H6

Ref: AB-H00079039-M01
DDX54 monoclonal antibody (M01), clone 2H6

Información del producto

DDX54 monoclonal antibody (M01), clone 2H6
Información adicional
Size 100 ug
Gene Name DDX54
Gene Alias DP97|MGC2835
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDX54 (NP_076977, 778 a.a. ~ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 79039
Clone Number 2H6
Iso type IgG2a Kappa

Enviar uma mensagem


DDX54 monoclonal antibody (M01), clone 2H6

DDX54 monoclonal antibody (M01), clone 2H6