AHNAK polyclonal antibody (A01)
  • AHNAK polyclonal antibody (A01)

AHNAK polyclonal antibody (A01)

Ref: AB-H00079026-A01
AHNAK polyclonal antibody (A01)

Información del producto

AHNAK polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name AHNAK
Gene Alias AHNAKRS|MGC5395
Gene Description AHNAK nucleoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AHNAK (NP_076965, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 79026

Enviar uma mensagem


AHNAK polyclonal antibody (A01)

AHNAK polyclonal antibody (A01)