DUSP26 polyclonal antibody (A01)
  • DUSP26 polyclonal antibody (A01)

DUSP26 polyclonal antibody (A01)

Ref: AB-H00078986-A01
DUSP26 polyclonal antibody (A01)

Información del producto

DUSP26 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name DUSP26
Gene Alias DUSP24|LDP-4|MGC1136|MGC2627|MKP8|NATA1|SKRP3
Gene Description dual specificity phosphatase 26 (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP26 (NP_076930, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 78986

Enviar uma mensagem


DUSP26 polyclonal antibody (A01)

DUSP26 polyclonal antibody (A01)