BOLL monoclonal antibody (M10), clone 1A2
  • BOLL monoclonal antibody (M10), clone 1A2

BOLL monoclonal antibody (M10), clone 1A2

Ref: AB-H00066037-M10
BOLL monoclonal antibody (M10), clone 1A2

Información del producto

BOLL monoclonal antibody (M10), clone 1A2
Información adicional
Size 100 ug
Gene Name BOLL
Gene Alias -
Gene Description bol, boule-like (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BOLL (NP_149019, 185 a.a. ~ 283 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 66037
Clone Number 1A2
Iso type IgG2a Kappa

Enviar uma mensagem


BOLL monoclonal antibody (M10), clone 1A2

BOLL monoclonal antibody (M10), clone 1A2