BOLL purified MaxPab rabbit polyclonal antibody (D01P)
  • BOLL purified MaxPab rabbit polyclonal antibody (D01P)

BOLL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00066037-D01P
BOLL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BOLL protein.
Información adicional
Size 100 ug
Gene Name BOLL
Gene Alias -
Gene Description bol, boule-like (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BOLL (NP_932074.1, 1 a.a. ~ 295 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 66037

Enviar uma mensagem


BOLL purified MaxPab rabbit polyclonal antibody (D01P)

BOLL purified MaxPab rabbit polyclonal antibody (D01P)