RASL11B purified MaxPab mouse polyclonal antibody (B01P)
  • RASL11B purified MaxPab mouse polyclonal antibody (B01P)

RASL11B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065997-B01P
RASL11B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

RASL11B purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name RASL11B
Gene Alias MGC2827|MGC4499
Gene Description RAS-like, family 11, member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RASL11B (NP_076429.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65997

Enviar uma mensagem


RASL11B purified MaxPab mouse polyclonal antibody (B01P)

RASL11B purified MaxPab mouse polyclonal antibody (B01P)