WNK4 monoclonal antibody (M02), clone 1E6
  • WNK4 monoclonal antibody (M02), clone 1E6

WNK4 monoclonal antibody (M02), clone 1E6

Ref: AB-H00065266-M02
WNK4 monoclonal antibody (M02), clone 1E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant WNK4.
Información adicional
Size 100 ug
Gene Name WNK4
Gene Alias PHA2B|PRKWNK4
Gene Description WNK lysine deficient protein kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WNK4 (NP_115763.2, 1144 a.a. ~ 1243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65266
Clone Number 1E6
Iso type IgG1 Kappa

Enviar uma mensagem


WNK4 monoclonal antibody (M02), clone 1E6

WNK4 monoclonal antibody (M02), clone 1E6