C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)
  • C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00065265-D01P
C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C8orf33 protein.
Información adicional
Size 100 ug
Gene Name C8orf33
Gene Alias FLJ20989
Gene Description chromosome 8 open reading frame 33
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C8orf33 (AAH10001.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65265

Enviar uma mensagem


C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)