C8orf33 purified MaxPab mouse polyclonal antibody (B01P)
  • C8orf33 purified MaxPab mouse polyclonal antibody (B01P)

C8orf33 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065265-B01P
C8orf33 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

C8orf33 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name C8orf33
Gene Alias FLJ20989
Gene Description chromosome 8 open reading frame 33
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C8orf33 (AAH10001, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65265

Enviar uma mensagem


C8orf33 purified MaxPab mouse polyclonal antibody (B01P)

C8orf33 purified MaxPab mouse polyclonal antibody (B01P)