UBE2Z monoclonal antibody (M01), clone 4B1
  • UBE2Z monoclonal antibody (M01), clone 4B1

UBE2Z monoclonal antibody (M01), clone 4B1

Ref: AB-H00065264-M01
UBE2Z monoclonal antibody (M01), clone 4B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2Z.
Información adicional
Size 100 ug
Gene Name UBE2Z
Gene Alias FLJ13855|HOYS7|USE1
Gene Description ubiquitin-conjugating enzyme E2Z
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA,IF
Immunogen Prot. Seq IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2Z (NP_075567, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65264
Clone Number 4B1
Iso type IgG2a Kappa

Enviar uma mensagem


UBE2Z monoclonal antibody (M01), clone 4B1

UBE2Z monoclonal antibody (M01), clone 4B1