UBE2Z polyclonal antibody (A01)
  • UBE2Z polyclonal antibody (A01)

UBE2Z polyclonal antibody (A01)

Ref: AB-H00065264-A01
UBE2Z polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2Z.
Información adicional
Size 50 uL
Gene Name UBE2Z
Gene Alias FLJ13855|HOYS7|USE1
Gene Description ubiquitin-conjugating enzyme E2Z
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2Z (NP_075567, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 65264

Enviar uma mensagem


UBE2Z polyclonal antibody (A01)

UBE2Z polyclonal antibody (A01)