PYCRL monoclonal antibody (M01), clone 4F11
  • PYCRL monoclonal antibody (M01), clone 4F11

PYCRL monoclonal antibody (M01), clone 4F11

Ref: AB-H00065263-M01
PYCRL monoclonal antibody (M01), clone 4F11

Información del producto

PYCRL monoclonal antibody (M01), clone 4F11
Información adicional
Size 100 ug
Gene Name PYCRL
Gene Alias FLJ13852
Gene Description pyrroline-5-carboxylate reductase-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PYCRL (NP_075566, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65263
Clone Number 4F11
Iso type IgG2a Kappa

Enviar uma mensagem


PYCRL monoclonal antibody (M01), clone 4F11

PYCRL monoclonal antibody (M01), clone 4F11