RTN4R purified MaxPab mouse polyclonal antibody (B01P)
  • RTN4R purified MaxPab mouse polyclonal antibody (B01P)

RTN4R purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00065078-B01P
RTN4R purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

RTN4R purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name RTN4R
Gene Alias NGR|NOGOR
Gene Description reticulon 4 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RTN4R (NP_075380.1, 1 a.a. ~ 473 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65078

Enviar uma mensagem


RTN4R purified MaxPab mouse polyclonal antibody (B01P)

RTN4R purified MaxPab mouse polyclonal antibody (B01P)