ALS2CR7 polyclonal antibody (A01)
  • ALS2CR7 polyclonal antibody (A01)

ALS2CR7 polyclonal antibody (A01)

Ref: AB-H00065061-A01
ALS2CR7 polyclonal antibody (A01)

Información del producto

ALS2CR7 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name PFTK2
Gene Alias ALS2CR7
Gene Description PFTAIRE protein kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALS2CR7 (NP_631897, 242 a.a. ~ 347 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 65061

Enviar uma mensagem


ALS2CR7 polyclonal antibody (A01)

ALS2CR7 polyclonal antibody (A01)