ACD purified MaxPab rabbit polyclonal antibody (D01P)
  • ACD purified MaxPab rabbit polyclonal antibody (D01P)

ACD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00065057-D01P
ACD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACD protein.
Información adicional
Size 100 ug
Gene Name ACD
Gene Alias PIP1|PTOP|TINT1|TPP1
Gene Description adrenocortical dysplasia homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACD (AAH16904.1, 1 a.a. ~ 544 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 65057

Enviar uma mensagem


ACD purified MaxPab rabbit polyclonal antibody (D01P)

ACD purified MaxPab rabbit polyclonal antibody (D01P)