SLC26A6 MaxPab rabbit polyclonal antibody (D01)
  • SLC26A6 MaxPab rabbit polyclonal antibody (D01)

SLC26A6 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00065010-D01
SLC26A6 MaxPab rabbit polyclonal antibody (D01)

Información del producto

SLC26A6 MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name SLC26A6
Gene Alias DKFZp586E1422
Gene Description solute carrier family 26, member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWLQCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC26A6 (NP_599025.2, 1 a.a. ~ 758 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 65010

Enviar uma mensagem


SLC26A6 MaxPab rabbit polyclonal antibody (D01)

SLC26A6 MaxPab rabbit polyclonal antibody (D01)