MRPS6 purified MaxPab mouse polyclonal antibody (B01P)
  • MRPS6 purified MaxPab mouse polyclonal antibody (B01P)

MRPS6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064968-B01P
MRPS6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

MRPS6 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name MRPS6
Gene Alias C21orf101|MRP-S6|RPMS6|S6mt
Gene Description mitochondrial ribosomal protein S6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS6 (NP_115865.1, 1 a.a. ~ 125 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64968

Enviar uma mensagem


MRPS6 purified MaxPab mouse polyclonal antibody (B01P)

MRPS6 purified MaxPab mouse polyclonal antibody (B01P)