MRPS11 purified MaxPab mouse polyclonal antibody (B02P)
  • MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00064963-B02P
MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

MRPS11 purified MaxPab mouse polyclonal antibody (B02P)
Información adicional
Size 50 ug
Gene Name MRPS11
Gene Alias FLJ22512|FLJ23406|HCC-2
Gene Description mitochondrial ribosomal protein S11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS11 (NP_073750.2, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64963

Enviar uma mensagem


MRPS11 purified MaxPab mouse polyclonal antibody (B02P)

MRPS11 purified MaxPab mouse polyclonal antibody (B02P)