CENPH purified MaxPab rabbit polyclonal antibody (D01P)
  • CENPH purified MaxPab rabbit polyclonal antibody (D01P)

CENPH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064946-D01P
CENPH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

CENPH purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name CENPH
Gene Alias NNF1|PMF1
Gene Description centromere protein H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CENPH (AAH12024, 1 a.a. ~ 247 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64946

Enviar uma mensagem


CENPH purified MaxPab rabbit polyclonal antibody (D01P)

CENPH purified MaxPab rabbit polyclonal antibody (D01P)