SLC30A5 monoclonal antibody (M03), clone 2E10
  • SLC30A5 monoclonal antibody (M03), clone 2E10

SLC30A5 monoclonal antibody (M03), clone 2E10

Ref: AB-H00064924-M03
SLC30A5 monoclonal antibody (M03), clone 2E10

Información del producto

SLC30A5 monoclonal antibody (M03), clone 2E10
Información adicional
Size 50 ug
Gene Name SLC30A5
Gene Alias FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5
Gene Description solute carrier family 30 (zinc transporter), member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64924
Clone Number 2E10
Iso type IgG2a Kappa

Enviar uma mensagem


SLC30A5 monoclonal antibody (M03), clone 2E10

SLC30A5 monoclonal antibody (M03), clone 2E10