SLC30A5 monoclonal antibody (M01), clone 2F10-2B8
  • SLC30A5 monoclonal antibody (M01), clone 2F10-2B8

SLC30A5 monoclonal antibody (M01), clone 2F10-2B8

Ref: AB-H00064924-M01
SLC30A5 monoclonal antibody (M01), clone 2F10-2B8

Información del producto

SLC30A5 monoclonal antibody (M01), clone 2F10-2B8
Información adicional
Size 100 ug
Gene Name SLC30A5
Gene Alias FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5
Gene Description solute carrier family 30 (zinc transporter), member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64924
Clone Number 2F10-2B8
Iso type IgG2b kappa

Enviar uma mensagem


SLC30A5 monoclonal antibody (M01), clone 2F10-2B8

SLC30A5 monoclonal antibody (M01), clone 2F10-2B8