SLC30A5 polyclonal antibody (A01)
  • SLC30A5 polyclonal antibody (A01)

SLC30A5 polyclonal antibody (A01)

Ref: AB-H00064924-A01
SLC30A5 polyclonal antibody (A01)

Información del producto

SLC30A5 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name SLC30A5
Gene Alias FLJ12496|FLJ12756|MGC5499|ZNT5|ZNTL1|ZTL1|ZnT-5
Gene Description solute carrier family 30 (zinc transporter), member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC30A5 (AAH00808.1, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64924

Enviar uma mensagem


SLC30A5 polyclonal antibody (A01)

SLC30A5 polyclonal antibody (A01)