PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)
  • PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064857-B01P
PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name PLEKHG2
Gene Alias CLG|DKFZp667J2325|FLJ00018|FLJ22458|FLJ38638
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFPQNAKPGFKHAGSEGELYPPESQPPVSGSAPPEDLEDAGPPTLDPSGTSITEEILELLNQRGLRDPGPSTHDIPKFPGDSQVPGDSETLTFQALPSRDSSEEEEEEEEGLEMDERGPSPLHVLEGLESSIAAEMPSIPCLTKIPDVPNLPEIPSHCEIPEGSRLPSLSDISDVFEMPCLPAIPSVPNTPSLSSTPTLSCDSWLQGPLQEPAEAPATRRELFSGSNPGKLGEPPSGGKAGPEEDEEGVSFTDFQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEKHG2 (AAH13426.1, 1 a.a. ~ 896 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64857

Enviar uma mensagem


PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHG2 purified MaxPab mouse polyclonal antibody (B01P)