USP46 purified MaxPab mouse polyclonal antibody (B01P)
  • USP46 purified MaxPab mouse polyclonal antibody (B01P)

USP46 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064854-B01P
USP46 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP46 protein.
Información adicional
Size 50 ug
Gene Name USP46
Gene Alias FLJ11850|FLJ12552|FLJ14283|FLJ39393
Gene Description ubiquitin specific peptidase 46
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP46 (NP_073743.2, 1 a.a. ~ 366 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64854

Enviar uma mensagem


USP46 purified MaxPab mouse polyclonal antibody (B01P)

USP46 purified MaxPab mouse polyclonal antibody (B01P)