C1orf80 purified MaxPab mouse polyclonal antibody (B01P)
  • C1orf80 purified MaxPab mouse polyclonal antibody (B01P)

C1orf80 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064853-B01P
C1orf80 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1orf80 protein.
Información adicional
Size 50 ug
Gene Name AIDA
Gene Alias C1orf80|FLJ12806|FLJ32421|RP11-378J18.7
Gene Description axin interactor, dorsalization associated
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTST
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1orf80 (NP_073742.2, 1 a.a. ~ 306 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64853

Enviar uma mensagem


C1orf80 purified MaxPab mouse polyclonal antibody (B01P)

C1orf80 purified MaxPab mouse polyclonal antibody (B01P)