ISL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ISL2 purified MaxPab rabbit polyclonal antibody (D01P)

ISL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064843-D01P
ISL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

ISL2 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name ISL2
Gene Alias FLJ10160
Gene Description ISL LIM homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ISL2 (NP_665804.1, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64843

Enviar uma mensagem


ISL2 purified MaxPab rabbit polyclonal antibody (D01P)

ISL2 purified MaxPab rabbit polyclonal antibody (D01P)