PORCN MaxPab rabbit polyclonal antibody (D01)
  • PORCN MaxPab rabbit polyclonal antibody (D01)

PORCN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00064840-D01
PORCN MaxPab rabbit polyclonal antibody (D01)

Información del producto

PORCN MaxPab rabbit polyclonal antibody (D01)
Información adicional
Size 100 uL
Gene Name PORCN
Gene Alias DHOF|FODH|MG61|MGC29687|PORC|PPN|por
Gene Description porcupine homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTWHKMRGAQMIVAMKAVSLGFDLDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAVQGRPLSCRWLQKVARSLALALLCLVLSTCVGPYLFPYFIPLNGDRLLRKWLRAYESAVSFHFSNYFVGFLSEATA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PORCN (NP_073736.2, 1 a.a. ~ 450 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 64840

Enviar uma mensagem


PORCN MaxPab rabbit polyclonal antibody (D01)

PORCN MaxPab rabbit polyclonal antibody (D01)