FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064838-D01P
FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name FNDC4
Gene Alias FLJ22362|FRCP1
Gene Description fibronectin type III domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FNDC4 (NP_073734.1, 1 a.a. ~ 234 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64838

Enviar uma mensagem


FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

FNDC4 purified MaxPab rabbit polyclonal antibody (D01P)