IL17E purified MaxPab mouse polyclonal antibody (B01P)
  • IL17E purified MaxPab mouse polyclonal antibody (B01P)

IL17E purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064806-B01P
IL17E purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

IL17E purified MaxPab mouse polyclonal antibody (B01P)
Información adicional
Size 50 ug
Gene Name IL25
Gene Alias IL-17E|IL-25|IL17E
Gene Description interleukin 25
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL17E (NP_073626, 1 a.a. ~ 177 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64806

Enviar uma mensagem


IL17E purified MaxPab mouse polyclonal antibody (B01P)

IL17E purified MaxPab mouse polyclonal antibody (B01P)